GenomeNet

>vvi:100853826 probable hexokinase-like 2 protein-like; K00844 hexokinase [EC:2.7.1.1] (A)
MRKAVVVAAVTTAAMAAAVAVLWSRWKQESERQWRKTRRILRKFARDCATPVSKLWLVAD
ALVSDMNEALTSQETTTLNMPISYVASLPSGDEEGLYYGLNLRGSNFLILRARLRGKNES
ISELHREEVSIPSNVMGGTSQELFDYIALELAKFISEHEVTTDDTPDRQKALGFIVSYPV
DQAAASSGAAIKWRSFSVTDTAGKALASNFNRALEKHGVNLRVLQLVEDAIGHLAGGRYY
NRDTVAAITLGMATTAAYVEPTQAVPEYQSSSNKSSEMVISMDWGNFNSCHLPITEFDTF
LDAESSNPGSRIFEKLTSGMYLGEIVRRVLLKMAQETALFGEDVPPKLRTPYLLRSPDMA
AMHQDTSEDHEVVHEKLMEIFRITNSTPLAREVVAEVCDIVAERGARLAGAGIVGITKKL
GRIENKRSAVTVEGGLYEHYRVFRNYMHSSVWEMLGNELSDNVVIEHSHGGSGAGAIFLA
ASQTNEPNS

BLAST