GenomeNet

>vvi:7498516 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (RefSeq) rbcL, ViviM_p010; ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (A)
MSPQTETKASVGFIAGVKDYKLTYYTPEYETKPTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIFKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIIMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGEREITLGFVDLLRDDFVEKDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIRAASKWSPELAAACEVWKEIQFEFPAMDTL

BLAST