GenomeNet

>wbr:WGLp376 dadX; hypothetical protein; K01775 alanine racemase [EC:5.1.1.1] (A)
MPRKTTIRISSNALASNLRTIKNYANKSKVWSVIKSNAYGHTIKAALKGLKETSGFAVLE
LNEAVLLRENGWNGPILLLEGFFEESDLLEICQYKITTVIHNDWQLNYIKQYDIKSPIDV
YLKLNSGMNRLGFNEKDFIRTWYDLSNLKKISSLTLMSHFSLGFSTKTVNKQMNIIRKIF
KILNPTLCLANSTAIIFHTYTHKDWIRPGIILYGILPKENKKISKKFNLKPVMTLESRII
SIQNIKSKEYIGYGKNYYSNKSNLIGIVSCGYADGYPFSVPFSGTPVFVNGTRTQIIGSV
CMDMLTIDLNDCPNAKIGSKVELWGNNISINEISKLANTTSYELMCRISSRVLVKIE

BLAST