GenomeNet

>wsu:WS1028 K00850 6-phosphofructokinase 1 [EC:2.7.1.11] | (GenBank) ftsI; PFK PROTEIN (A)
MRIGLVCSGGDCAGMNPATKKFVEYSLELGYEPYFIREGLEGLIEGKIEPATLKEVSGIL
HKGGTILQSSRSKRFFDPAFRLQAYQNLQRHSIEALVTLGGDGSFRAMEVLAKEHSLLYA
GIPATIDNDIRASDYALGVDSALNVILESTDRLRDTAESFRRAFVVEVMGRDCGYLALAS
AIACGAEVCIIPEMGYSLQSLGARLKEELGTGKRRYVLAIVSEGAKASSEVVSWLKEEVG
IETRITILGHVQRGGSPSVYDRLMGFRFMQKALDSLSLGKSGVVVLREGRVEFLSSQEAS
SAPASLPLDMVRLASRLMF

BLAST