GenomeNet

>xac:XAC0708 lacZ; hypothetical protein; K01190 beta-galactosidase [EC:3.2.1.23] (A)
MALPDALHVFRLQRLKSIGCNAIRLHHAVAPELLQACDRLGMLVMAENRLFNPAPDYVAL
LRNMVRRQRNHPSVFLWSLLNEEPLQGTATGYAITARAASAVRALDDTRPITAGMNDGMF
ATGGAADVVDVLGFNYRQYNYDRVHAARPRTPMLSSEDTSAFQTRGAWFTDLDAHVVAED
DSLAADWGNTHRRAWQLIAERPFVAGSFVWTGFDYRGEPTPFEWPSVGAFFGIMDQCGFA
KGAYWLRRALWIDDAPVLHLLPHWNWPGREGQPIKVMAFCNAEQVELWLNGRSLGKQAVD
RAQSNQWQVDYAPGVLEAVAWRGGHEVARTRVETTGAPVALKLTPDRSELHGDGRDAQPV
TLEAVDAQGRHVPDCNALLTLQISGGRLLGIGNGDPNSHAADQSTQVALFNGLAQAIVQA
GSGAGVLRLQASSPGLRDAVLDIGCTSAPLPASVPIAAPVMVVESWRHTAAFAQPPAPDL
PRRPNDNNSWSNTLPGTLESAPERAGYVLYRSQFTPWQGMQTRGGILDLGRLSGPAQVFL
DGRAVAQAAAGTPVTVALAPAAGERTLAVILQVAADQPFGFHDVVTVHYRNPP

BLAST