GenomeNet

>xal:XALC_0548 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gst; probable glutathione transferase protein (EC:2.5.1.18) (A)
MKLYAKPGACSLADHIVLRWAGLPFELQLLDAAAMKAPAYLAINPAGAVPALQMDDWVLT
QNSAILNYIADLAPDAHLAGDGSPRGRAEVQRWLAFLNADLHMAFPPLFGSTRYLDDPAA
IARTQEHARERVRTLYARVDAALEQKTWLGSMRRSIADAYLFVTMRWARAQQIPLGANLQ
LHFERMSADPQVQAALQAEGLS

BLAST