GenomeNet

>xal:XALC_0887 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (GenBank) hypothetical conserved peptidyl-dipeptidase protein (A)
MNHRHPLLGLCIAASLLFLSACRKDAAPENVAPATPHAIGESADQFVARINEQYRKQLPE
LTTAQWLSATYINADTQRLASEANARWLTTLNGWIAQAKRYQGQPMSADSARALQRLKQM
TAMPAPHDPAKLNELTALAAKMEGAYAVATSCSGEGDARRCRQLDELEEVLRRSRDYDQQ
LDAWQSWHATAQPLRKDYPRFVELVNEGAREMGYADTGAMWRSGYDMPPAQLVAETDRLW
AQVKPLYEQLHCYARSKLDTEYGKDKGEVAGGLLPAHLLGNMWQQDWSNLWDLLQPYRDA
SNLDITDALERQYQSDLSAALARRNGDTSAEARFMAQREAQSLSARQMNEHAQDFYTSLA
MPKLPDSYWSRSQFIKPLDRDVDCHASAWNMDMAGDVRAKMCVKPDEEDFATLYHELGHV
YYYLAYDSLPPLFQSGANDGFHEAIGDTVVLALTPQYLHTIALTETPQVSREALINTQMR
MALNKVAFLPFGLMIDRWRWGVFDGSIGPDRYNQAWWELKAKYQGVAPVAPRGEAFFDPG
AKYHVPANTPYTRYFLSHILQFQFYKSLCDAAGHKGPLYACTFYGNKEAGQKFWSMLQRG
ASQPWQATLKELTGSERLDAGPLLEYFAPIQQWLKQQNQGRLCGWDTPKPTTAH

BLAST