GenomeNet

>xal:XALC_1668 sucA; probable 2-oxoglutarate dehydrogenase protein (EC:1.2.4.2); K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] (A)
MDNLLKQFAQSSQLAAGNAAYIEDLYEQYLVSPDSIDPKWKTYFDGFQGRDAGDVPHSAV
IAHIASAARQAGNSGTGPSGDERERHVGRLITAYRSRGHLGARLDPLGLTPPINPPDLGL
PFHSLSESDLGSEFSTGGLGGQPRMKLRDLLARLKATYTGSIGSEFMHISEFEQRQWIYQ
RLENVGGQITADVASRRRILERITAAEGLERYLHTKYVGQKRFSLEGGDALIPLMDVLVQ
RGGSDAVKDIVIGMAHRGRLNVLVNTLGKNPRKLFDEFEGKFEHAHDDRAHTGDVKYHMG
FSADVAVANGASVHLALAFNPSHLEIVDPVVVGSVRSRQERYGDAARKSVLPVIIHGDAA
FAGQGVVMELFQMSQARGFAVGGTVHIVINNQIGFTTSARDDARSTLYCTDVAKMIGAPV
FHVNGDDPDAVAFVANIAYDFRQKFNKDVVIDLVCYRRWGHNEADEPAATQPVMYQTIRK
HKTTRELYAAQLESEGVLQPGEGQALVDAYRNKLDSGEYTTELAPRKHDEFAIDWSKYLS
GKLSDKVNTTVKRKTLDQLAKIITTIPESVELHPRVAKIYEDRVKMAAGELPADWGFAEN
LAYATLLNEGHKLRLVGQDAGRGTFFHRHAILHDQKNDSYYLPLRQLVQNPEDATVIDSL
LSEEAVMGFEYGYSTTDPNALCIWEAQFGDFANGAQVVIDQFIAAGEAKWGRIAGLSLFL
PHGYEGQGPEHSSARLERFLQLCALENMLVCVPTTPAQAFHMIRRQMRMSTRKPLVVMTP
KSLLRHKLAVSSLKELADGEFQHLIPDSKAEPKKVKRVIACSGKVYYDLLEDQLKRGQED
VAILRVEQLYPFPRALLAAELKRYGNATDLVWCQEEPQNQGAWYQIKHHLQACLADGQSL
HYAGRPRSPSPAAGHLAEHLEEQLKLVADALLNPFNDQVAE

BLAST