GenomeNet

>xal:XALC_2789 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) ppc; probable phosphoenolpyruvate carboxylase protein (EC:4.1.1.31) (A)
MNESRNNIVFATPDLPLRDDVRRLGALVGELLAEQVSGAFLEEIERIRIAAIARRERNAP
SSLLSQSLSGRTPREAEALVRAFSTYFQVVNIAERVHRIRRRRDYQRSSADTPQPDGLHD
ALYRLKAQGVSVQELSDWLPRLDVEPVFTAHPTEAVRRALLEKEQLMVASLVDHLDGMRT
PGEQATDAARLRMALTATWQTADSSPVRPTVEDEREHVGFYLNQVLYRVIPVMYETLEHA
IEQTYGQSLHLPRLLRFGTWVGGDMDGNPNVDATTMTATLDAQRRAVLERYLKELRQLAS
LLSQSIILVGVSAPLLEQLERYRQLLPQAAARSRPRHADMPYRLLNDLMRARLQATLDDA
PGGYAAPSELEHDLQLILDSLRANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVH
ARAVAAALGVQEWEALPAAERARLLGPYAGGETPLPACADAGNARLDAVFAALADARARH
GADALGSYIISMAHDRADVLTVLALARRGGLVDAADAVPLDIVPLFETVDDLRGGTATLR
DLLADPVYRRHLDARGDVQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAGESGIRLT
FFHGRGGSIVRGGGKTTRALEAAPPGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRPVDAREAQWRPVMDRVAEHSSQAYRHFVGDAEFMRYFRLATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEAALRAMA
IDWPFFRTFLDDIAMVLSKGDLNIAEMFSHLAGPLHERFFPRIRDELALTKHWVKALTGQ
ASLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEELLRALVACVNGVAQGL
QNTG

BLAST