GenomeNet

>xal:XALC_2812 ddl; probable d-alanine-d-alanine ligase protein (EC:6.3.2.4); K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MSMPSLSPSRYTDPSVFGRVAVLLGGSSSERDVSLTSGANVLDALRSRGVDAQPVDGIAA
LLERIRAGAVDRVFNILHGGDGENGVLQGLLRALQVPFTGADVLGSALTLDKIRTKQVWI
AAGLPTPGFARIAADADLAAAAAELGYPLFVKPSCEGSSVGVFRVLSAVDLAPVRAFAAD
YAGELLMEQMVQGEEYTVGILGDIALPSIRIVPVGDWYDYHAKYIAEDTQYLCPGLSGED
EVQIRQLALQAFAAAGCSGWGRVDVMRDRVRGLQLIEINTAPGMTSHSLVPKAAAHLGID
LASLCWRILEQTLPEVAAR

BLAST