GenomeNet

>xal:XALC_3137 putative isocitrate dehydrogenase protein (EC:1.1.1.42); K00031 isocitrate dehydrogenase [EC:1.1.1.42] (A)
MSALPNPAAVRLPARTIAVAEGDGIGPEITRAVLKILTAADPGLSFTPLTVGLEAYRAGH
AAGFDRSVIDAVTEHGVLLKGPITTPQGGGYKSVNVSLRKTFGLYANLRPCVAYHPFVAT
HHPGMDVVIVRENEEDTYAGIEHQQTDEVVQCLKLVSRPGCERIVRYAFEYARAHGRGKV
TCMTKDNIMKLTDGLFHRVFDEIAKEYPEIANDHMIIDIGTAKMAVDPRRFDVVVTPNLY
GDILSDVAAEVAGSIGLAPSSNIGRHCAMFEAVHGSAPDIAGRDLANPSGLLLSAVMMLV
HLQRPAAATAIHNAWLRTLEEGLHTADIFGSHSQRQVGTQEFADAVIARLGQKPQQIAAV
DYPEQPKQSAAPVIESARAKVAKTLEGVDVFVHWDHPGRDADTLGNQLQALAGPDLRLAL
ITNRGVKVYPSGLQQTTRTDHWRCRFLAADGTTLKPAHICSLLLRLSEAGFETVKTENLY
AFDGVRGYSQAQGE

BLAST