GenomeNet

>xal:XALC_3137 K00031 isocitrate dehydrogenase [EC:1.1.1.42] | (GenBank) putative isocitrate dehydrogenase protein (A)
MSALPNPAAVRLPARTIAVAEGDGIGPEITRAVLKILTAADPGLSFTPLTVGLEAYRAGH
AAGFDRSVIDAVTEHGVLLKGPITTPQGGGYKSVNVSLRKTFGLYANLRPCVAYHPFVAT
HHPGMDVVIVRENEEDTYAGIEHQQTDEVVQCLKLVSRPGCERIVRYAFEYARAHGRGKV
TCMTKDNIMKLTDGLFHRVFDEIAKEYPEIANDHMIIDIGTAKMAVDPRRFDVVVTPNLY
GDILSDVAAEVAGSIGLAPSSNIGRHCAMFEAVHGSAPDIAGRDLANPSGLLLSAVMMLV
HLQRPAAATAIHNAWLRTLEEGLHTADIFGSHSQRQVGTQEFADAVIARLGQKPQQIAAV
DYPEQPKQSAAPVIESARAKVAKTLEGVDVFVHWDHPGRDADTLGNQLQALAGPDLRLAL
ITNRGVKVYPSGLQQTTRTDHWRCRFLAADGTTLKPAHICSLLLRLSEAGFETVKTENLY
AFDGVRGYSQAQGE

BLAST