GenomeNet

>xcc:XCC0190 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (RefSeq) yojM; superoxide dismutase-like protein (A)
MQQAEAPLASASGSLVSGRVVLVPALRGIRLTGTVGGLRPGAVAGFHVHERGDCSAADAS
SAGGHFNPTGAAHGRAGNGSHHLGDMDNLRADAEGVAHLDMILSDITLGDAAPSDVLGKA
LIVHADADDYRSQPSGNAGARLACGVIRATKWQTPPSQP

BLAST