GenomeNet

>xce:Xcel_1675 no KO assigned | (GenBank) DNA polymerase LigD, polymerase domain protein (A)
MPPSAAPAVEVDAAGRPVRVSSPDRVVFPALGITKLQVVEYFLAVGDGILGALLHRPTTL
ERWPKGFFDGAVMATRADSRGDAFYQKRVPQGAPEYVETATIAFPSGRTAAEVAPTELAV
VAWAANLGTLTFHPWPVRRDDVEAVDQLRIDLDPQPGTTFDDAARVAPVLREVLGELGLT
GYPKTSGGRGLHVFVPIAPRWSFAQARRATIAIGRELERRLPDQVTTRWWKEERGERIFV
DYNQMARDRTIASAYSVRARAQATVSAPLTWDEVGTVRPADFDLTTMPARFAEVGDLFAP
LRADRDPALDCSLDAALELARRDEEEHGLGDLPYPPEYPKMPGEPKRVQPSRDRDRPRDD
AEDGGPGQAPR

BLAST