GenomeNet

>xce:Xcel_1675 DNA polymerase LigD, polymerase domain-containing protein (A)
MPPSAAPAVEVDAAGRPVRVSSPDRVVFPALGITKLQVVEYFLAVGDGILGALLHRPTTL
ERWPKGFFDGAVMATRADSRGDAFYQKRVPQGAPEYVETATIAFPSGRTAAEVAPTELAV
VAWAANLGTLTFHPWPVRRDDVEAVDQLRIDLDPQPGTTFDDAARVAPVLREVLGELGLT
GYPKTSGGRGLHVFVPIAPRWSFAQARRATIAIGRELERRLPDQVTTRWWKEERGERIFV
DYNQMARDRTIASAYSVRARAQATVSAPLTWDEVGTVRPADFDLTTMPARFAEVGDLFAP
LRADRDPALDCSLDAALELARRDEEEHGLGDLPYPPEYPKMPGEPKRVQPSRDRDRPRDD
AEDGGPGQAPR

BLAST