GenomeNet

>xcv:XCV1636 K00858 NAD+ kinase [EC:2.7.1.23] | (GenBank) ppnk; inorganic polyphosphate/ATP-NAD kinase (EC:2.7.1.23) (A)
MTAPPRIAFLASPAEPAVAARARLTQRYGDHALDSADIVCALGGDGFMLQTLHRHGAADK
PVFGMKLGSVGFLMNQYRDNEDDLLERLQRAEPAYLRPLEMQVQTESGASAGSLAYNEVS
LLRQTRQAAHLSVDLNGQTRIAELIGDGVMVATPAGSTAYNYSAHGPILPLGSHTLALTP
IAPYRPRRWRGAILKADTEVRFRVLDPYKRPVSVTADSHEIRDVVEVTIRESTQRQVTLL
FDPEHNLEERIFSEQFAV

BLAST