GenomeNet

>xft:PD1654 ttg2A; toluene tolerance protein; K02065 putative ABC transport system ATP-binding protein (A)
MILPTPAVQLSGVRIERGGRTVLSNVALQVPRGSITTVLGPSGSGKSTMLAALTGELRPT
EGEVRLFGDGIPQGTQALLEMRRNLGVLLQGNGLLTDLSVAENVALPLRAHTRMPEPLLQ
RLVLMKLHAVGLRAAAEAMPRELSGGMARRVALARALALDPPLMIYDEPLTGLDPIASGV
IVSLIKRLNDSLGLTTIIVSHHVHETLPICDQAVVIANSTVIFAGTPAQLEASNDALVYQ
FMHGQPDGPIPFDAAPRTSERSSA

BLAST