GenomeNet

>xla:379580 K03355 anaphase-promoting complex subunit 8 | (RefSeq) cdc23.L, cdc23; cell division cycle 23 L homeolog (A)
MAATIGMFSDLKEIKRQLLSVTWLCRERGLMNSVKWASELAFSLESVPLNELPSTPALTE
EDAQDLDAYMLAKSYFDLKEYDRAAYFLRGCKSQKAYFMYMYSRYLSGEKKKDDETVDSL
GPLEKGQVKNEALREVRVELSKKHKARELDGFGLYLYGVVLRKLDLAKEALDVFVEATHV
LPLHWGTWLELCNLITDKEMLKFLSLPDSWIKEFFLAHIYTELQLIEEALQKYQSLIDAG
FSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRGLKPELSY
LAHNLCDIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEM
KNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVA
LGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDIY
SCGEIVEHQEVSTAFRYLAQYYFKCKLWDEASACAQKCFNFNDTREEGKALLRQILQLRN
QSESPSAEPATAPFFLPQSLSANNTPTRRVSPLNLSSVTP

BLAST