GenomeNet

>xla:379765 ckm, ckmm, m-ck; creatine kinase, muscle (EC:2.7.3.2); K00933 creatine kinase [EC:2.7.3.2] (A)
MPFGNTHNNFKLNYSAEDEYPDLTKHNNHMAKVLTPDIYKKLRDKQTPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKDLLDPVIEDRHGGYKPTDKHKTDLNFANLKGGDD
LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSIQALSSLSGEFKGKYYPLKDMS
DAEQQQLIDDHFLFDKPVSPLLLAAGMGRDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMKEVFRRFCEGLTKIEEIFKQAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHAKLP
NLSKHPKFEEILTRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVDQVQMVVDGVKLM
IEMEKKLEKGQTIDDMMPAQK

BLAST