GenomeNet

>xla:379765 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) ckm.L, ckm, ckm.S, ckmm, m-ck; creatine kinase, muscle L homeolog (A)
MPFGNTHNNFKLNYSAEDEYPDLTKHNNHMAKVLTPDIYKKLRDKQTPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKDLLDPVIEDRHGGYKPTDKHKTDLNFANLKGGDD
LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSIQALSSLSGEFKGKYYPLKDMS
DAEQQQLIDDHFLFDKPVSPLLLAAGMGRDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMKEVFRRFCEGLTKIEEIFKQAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHAKLP
NLSKHPKFEEILTRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVDQVQMVVDGVKLM
IEMEKKLEKGQTIDDMMPAQK

BLAST