GenomeNet

>xla:380055 ckb, b-ck, ckbb; creatine kinase, brain (EC:2.7.3.2); K00933 creatine kinase [EC:2.7.3.2] (A)
MEQPIIKRLSTEEEYPDLSKHNNHMAKVLTLDMYKKLRSRTTSSGFTLDDVIQTGVDNPG
HPFIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPTDQHKTDINSANLKGGDDLDPNY
VLSSRVRTGRSIRGYSLPPHCSRGERRAIEKMSIEALASLDGDLKGKYYALNSMTEQEQQ
QLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGN
MKEVFNRFCTGLTKIESIFKNKGSPFMWNQHLGYVLTCPSNLGTGLRAGVHIKLPNLSKN
DKFGEILKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLVEMEK
RLEKGESIDDLIPAQK

BLAST