GenomeNet

>xla:386605 tgm2; protein-glutamine gamma-glutamyltransferase; K05625 transglutaminase 2 [EC:2.3.2.13] (A)
MAEELYLESFDLDCSGNNRSHRTAEASCEQLIVRRGQPFQITLNFSPRGYEEGVDKLSLN
AITGPCPSEESGTRSHIPVSDALQDGTWSAAVKSTDGGTVILSITSPPDARIGDYNFTLE
TSTESQGSSFQLGSFKLLFNPWCPEDSVYLENEEERKEYVLCQHGIIFQGTKDSVEHVPW
NFGQFEDGMLEIALQILDTSPKFLNDSNRDCSRRNDPVYISRVISAMVNCNDDKGVLYGR
WDNKYDDGVSPMFWMGSVAILRRWRKFSCQAVKYGQCWVFGAVACTVLRCLGIPARVITN
YNSAHDTNSNLLIEQYLDEQGKRQAKQKDIIWNYHCWVEAWMGRPDLGEAYNGWQVVDPT
PQEKSEGTYCCGPAPVKAVKEGDLNLKYDVPFVFAEVNADVAYYVQQNDGSVKKTQFISL
VGQKISTKAIGKDEREDITHNYKYPEGSEDERRVFEKANKQFGEGEVNEKSLDVSIEIKV
SEGMNKGFDFDVFAVITNNTEAEKQCRLMFCARTSSYNGEVGPECGMKDLLNVTLPPQEE
KRVPLRILYEKYGPTITDNNMIKLVAMLFDYSSKDIILAMRDIHIKNPSIKIKILGEPKQ
KRKLVAEISLKNPLAEPLTDCCFTVEGAGLTAEQLVQTLDCPVEPGQDAKVRVDLMPQLP
GKLSLVVNFESDLLKAVKGYRNIIIAPLPK

BLAST