GenomeNet

>xla:397857 K04366 RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1] | (RefSeq) raf1.S, c-raf, raf, raf-1, raf1; Raf-1 proto-oncogene, serine/threonine kinase S homeolog (A)
MEHIQGAWKTLSNGFGFKESVFEGSSCMSPTIGHQFGYQRRASDDGKLSDTSKTSSTMRV
YLPNKQRTVVNVRSGMSLHDCLMKSLKVRGLQPECCAVFRLIQDPKGKLRLDWNTDAMSL
VGAELQVDFLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVP
TMCVDWSNIRQLLLFPNPNNIEGGSHTLPSLTMRRMRESVRIPVSSQQRYSTPHPFSFST
PSPVSECSLSQRQRSTSTPNVHMVSTTMAVDSRVIEDALRSHSESGSPNNLSPTGWSNAK
APAPTHREKAASSTGQEKNKIRPRGQRDSSYYWEIEASEVMLSSRIGSGSFGTVYKGKWH
GDVAVKILKVTDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSL
YYHLHVLDTKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGL
ATVKTRWSGSQQVEQLTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYS
HIRDRDQIIFLVGRGGVVPDLSKLYKNCPKAMKRLVADSIKKLRDERPLFPQILSSIELL
QHSLPKINRSASEPSLHRAAHTEDISSCALTSTRLPVF

BLAST