GenomeNet

>xla:397857 c-raf, raf, raf1; raf protein (EC:2.7.11.1); K04366 RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1] (A)
MEHIQGAWKTLSNGFGFKESVFEGSSCMSPTIGHQFGYQRRASDDGKLSDTSKTSSTMRV
YLPNKQRTVVNVRSGMSLHDCLMKSLKVRGLQPECCAVFRLIQDPKGKLRLDWNTDAMSL
VGAELQVDFLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVP
TMCVDWSNIRQLLLFPNPNNIEGGSHTLPSLTMRRMRESVRIPVSSQQRYSTPHPFSFST
PSPVSECSLSQRQRSTSTPNVHMVSTTMAVDSRVIEDALRSHSESGSPNNLSPTGWSNAK
APAPTHREKAASSTGQEKNKIRPRGQRDSSYYWEIEASEVMLSSRIGSGSFGTVYKGKWH
GDVAVKILKVTDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSL
YYHLHVLDTKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGL
ATVKTRWSGSQQVEQLTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYS
HIRDRDQIIFLVGRGGVVPDLSKLYKNCPKAMKRLVADSIKKLRDERPLFPQILSSIELL
QHSLPKINRSASEPSLHRAAHTEDISSCALTSTRLPVF

BLAST