GenomeNet

>xla:398276 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) tk2.S, tk2; thymidine kinase 2, mitochondrial S homeolog (A)
MSVLLAARTCIRLCCTEHKTGALARFNLGANTALTVRRIASALCGRCNIMRRGILPSGST
GNGLKSREKSTVICVEGNIASGKTSCLDYFSNTPDLEVFKEPVAKWRNVCGHNPLGLMYQ
DPNKWGLTLQTYVQLTMLDIHTKPSISPVKMMERSIYSAKYIFVENLYQSGKMPAVDYAI
LTEWFKWIVKNTDTSVDLIVYLQTSPEICYQRLKKRCREEESVIPLEYLCAIHNLYEDWL
VKQTSFSVPAPVLVIDGNKELEELTQHYEENRTSILSL

BLAST