GenomeNet

>xla:398276 tk2; thymidine kinase 2, mitochondrial (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MSVLLAARTCIRLCCTEHKTGALARFNLGANTALTVRRIASALCGRCNIMRRGILPSGST
GNGLKSREKSTVICVEGNIASGKTSCLDYFSNTPDLEVFKEPVAKWRNVCGHNPLGLMYQ
DPNKWGLTLQTYVQLTMLDIHTKPSISPVKMMERSIYSAKYIFVENLYQSGKMPAVDYAI
LTEWFKWIVKNTDTSVDLIVYLQTSPEICYQRLKKRCREEESVIPLEYLCAIHNLYEDWL
VKQTSFSVPAPVLVIDGNKELEELTQHYEENRTSILSL

BLAST