GenomeNet

>xla:398711 K18494 histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43] | (RefSeq) setdb2.S, clld8, setdb2; SET domain, bifurcated 2 S homeolog (A)
MEQSANARQSTLRSRTQELNTLSVLSKDVSLEDAKKYWKDRQADGKVDWIFEKVLNKLKI
LWQKIKDGSATNLEYVRAVILVNEAGNLEEDLEEDLQEDTDTIHIDIHKENEVQENTDCS
PERKEDTCLNLNTDCGTDVSGSEPECNSTVSPPAAERVYFGNHSCGPSCLSGINPFLFTK
GNPLQLPISCDFQRCHLKINSPDDLSHILYKAPCGRSLRDYDEVHSYLTETGCHFLAVDN
FSFNNHVRLDSNSSFNQGIVQDCDISNDVESVPVAFSNEIDNTRPSNFIYRKTSWPPGYS
LNNFTDIFVKCCNCTDGCLDILTCSCLQLTAQAFTKCMESSLGIGPLGYKHKRLQEPIPT
GLYECNVSCKCDRMLCQNRVVQHGLKLRLQVFKTNTKGWGVRCLDDVDKGTFVCIYAGRI
LIRTADCTVKSTPDDSVACGNEDHEDSTSTCALILSKRKRKTSHSDSEVTVMHTNPYSMR
SHGLSVHRLSNTFSPRQARSGEREFSLQPLRRPKTKTSMLQKRRRQLIEEGACTVQNSSE
EEGPTPPQSPEQKSSAGTKIQRNENSDETASGYVSEESSSSVISGGHPLEKPISKFKSKL
NKTTVYLSTSPEQTCEENLHFLDASKEGNVGRFLNHSCCPNLFVQQVFVDTHQKCFPWVA
FFTNSVVKAGTELTWDYSYDIGTAADQEIQCLCGQKHAK

BLAST