GenomeNet

>xla:398855 K01084 glucose-6-phosphatase [EC:3.1.3.9] | (RefSeq) g6pc.L, g6pt, gsd1, gsd1a; glucose-6-phosphatase, catalytic subunit L homeolog (A)
MEMGMDNLHSTGVYVVKYLQENFIKSQDWFVFVSFAADLKNTFLILFPIWFHISESVGVK
LVWVAVIGDWLNLVFKWILFGQRPYWWVHETTFFVNNSAPTILQFPVTCETGPGSPSGHA
MGSSAVYYVMAHAVLSVLLENKTTLRSQFQRWALWLFFWSVQVNVCLSRVFVAAHFPHQV
IAGVCSGMLVAKIFNHVHCIYNVSFKRYIYATLFLFFFALGFYLILKVFGIDLLWALEKA
KRWCARPEWIHIDTTPFAGLLRNLGVFFGLGLALDTQMYRDSCREKKGGQFTFRLCCIMI
SLLVLHLFDSLELPADKEILFYFLSFCRSVAVSLTVVAVIPFCISHALQWQKKKVT

BLAST