GenomeNet

>xla:399028 uncharacterized protein MGC68458; K13524 4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22] (A)
MASVLLARQVTLNLQQNTRLLVPCVRYVSQAAAKKNVDFEYDGPLMKTEVPGPRSKELIK
QLSKIQNSEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYNHPALIKVLQQPQ
NLSSFVNRPALGILPPENFTEKLEDSLLSIGPKGLRQVITMSCGSCSNENAFKLIFMWYR
NKERGPTGVTKEELDSCMINQLPGCPDYSILSFMGGFHGRTMGCLATTHSKAIHKLDVPS
FDWPIAPFPRLKYPLEQFVKENQDEEARCLEEVEDLIVKYRKKKKTVAGIVVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGSTGKFWAHEHWGMDDPADVVTFSKKMI
TGGFFHKEELRPDAPYRIFNTWLGDPSKNLLLAEVLNVIKREDLLSNTVQAGKALHDGLL
DFQARYPHLVSRARGRGTFCSFDAPSDAIRNQIILQARNKGIVLGGCGDKSIRFRPTLVF
KEHHAHLFLNIFNDILADFK

BLAST