GenomeNet

>xla:399314 cdk2, eg1; cyclin-dependent kinase 2 (EC:2.7.11.22); K02206 cyclin-dependent kinase 2 [EC:2.7.11.22] (A)
MENFQKVEKIGEGTYGVVYKARNRETGEIVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLNQDLKKFMDRSNISGISLALVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINSDGAIKLADFGLARAFGVPVRTFTHEVVTLWYRAPEILLGCKFY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTF
PKWIRQDFSKVVPPLDEDGRDLLAQMLQYDSNKRISAKVALTHPFFRDVSRPTPHLI

BLAST