GenomeNet

>xla:399314 K02206 cyclin-dependent kinase 2 [EC:2.7.11.22] | (RefSeq) cdk2.S, cdk2, eg1; cyclin-dependent kinase 2 S homeolog (A)
MENFQKVEKIGEGTYGVVYKARNRETGEIVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLNQDLKKFMDRSNISGISLALVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINSDGAIKLADFGLARAFGVPVRTFTHEVVTLWYRAPEILLGCKFY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTF
PKWIRQDFSKVVPPLDEDGRDLLAQMLQYDSNKRISAKVALTHPFFRDVSRPTPHLI

BLAST