GenomeNet

>xla:399470 ralb, KRAS2, k-ras, xralb; v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein); K07827 GTPase KRas (A)
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQFRLKKMSKEEKTPGC
VKFKKCRVM

BLAST