GenomeNet

>xla:399470 K07827 GTPase KRas | (RefSeq) ralb, KRAS2, k-ras, xralb; v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (A)
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQFRLKKMSKEEKTPGC
VKFKKCRVM

BLAST