GenomeNet

>xla:431912 uncharacterized protein MGC82298; K00693 glycogen(starch) synthase [EC:2.4.1.11] (A)
MPLSRSLSVSSLNGLPLWQDEDLPLQDLLLFEVAWEVTNKVGGIYTVIQTKAKVTADEWG
DNYFLMGPYMEHNVRTQVEICDPPNGHIRKAIDVLQSQGCQVYFGRWLIEGNPYVVLFDI
GSAAWNLDRWKGEFWDCCTVGIPYNDREANDALIFGSLTAWFLKELTDQFQDKPGVIAHF
HEWQAGAGLVLCRNQKLPVATIFTTHATLLGRYLCAANVDFYNQLDQFDIDREAGDREIY
HRYCMERAAVHCAHVFTTVSQITGIEAEHMLKRKPDVITPNGLNIKKFSATHEFQNLHAM
YKAQIQEFVRGHFYGHLDFSLEKTLFFFIAGRYEYTNKGADIFLEALSRLNFLLRVHRSD
VTVVVFFIMPTKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYEALLKGEIPDLNKI
LDRDDVTIMKRAIFATQRQSLPPITTHNMVDDSTDPILNTVRRIGLFNSRTDRVKIIVHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPTAYGVYITDRRFRSPDESCNQLTQLLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRFYKHARHLALCRMFPDKFQMEPSAPPKTEGFRYPRPSSVPPSPAVSQPSSPHDSEE
EDDEERYDEDEEAERDRQNIKSTFSFGPVSRGKKKKHGENRN

BLAST