GenomeNet

>xla:432147 K11421 histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43] | (RefSeq) setdb1.L, setdb1; SET domain, bifurcated 1 L homeolog (A)
MESQETMELEQMVVKELGISMDDLRELIDRELEKIEFVKQRKAQLLEMEQLVKQKEAEVD
HVDKLFDNATRAVDDCETLVKSLYDQIGMTYKESSSEDEGSSKPTEVIEIPDEDDDDVMS
VGSGEAVSKIPKEKHLLREAMAAMKRSRQDVQSIVEAIQKKSDGPQTRFSSHPSSPTSSV
GGSNQASASNDMSKDGDLVVGMRILGKKRTKTWHKGTLISIQCVGTGKKFKVKFDNKGKS
LLSGNHIAYDYHPPPENLTVGSRVVAKYKDGNQVWLYAGIVAEPPSSKNKMRYLIFFDDG
YASYVTHAELYPVCRPWSKSWEDIEDVSCRDFIQEYVNAYPNRPMVLLKSGQLIKTEWEG
TWWKSKVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSNASTQEKQQAGQQRTR
PNVGAIRSKGPVVQFTHDLTGNEPEHNPAAPPSPQSMPSPQLIDTDSDSQQAQSKKQVAK
KSTSFRPGSAGSGQSSPIPTESVPQPPAAPRPFQSNQSVQPVQSIQPIQPIHNIQTIQTI
QGIQTIQAIQPIQSIQTLQPIQTIQPLQTIQTLQGNRIVTSIQQFQIIRTENIPAESTYK
APKEKLFYLPHVCNYTCLSRIRPLSHRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYK
SPCGLSLRTMPEIERYLFETQCKMLFLEMFCLDPYVLVDRKFQPQKPFYYIPDITYGKED
VMLSCVNEIDRTPPPQVAYSKERIPGKGVFINTGADYLVGCDCTDGCRDKSKCACHQLTI
QATACTPGAQSNPMAGYQHKRLEECLPTGVYECNKRCKCSANMCNNRLVQHGLQVRLQLF
KTQNKGWGIRGLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKE
GYESDAKSSSDSSGVDLKEDHEENSGSEDQEESNDSSDDNFGKNEDITTSSVWRSYATRR
TTRGQKENGTSETASKDSRTRDETTDCKLPEETSKNKVASWLSSNTMADSVMDSDSRSSL
KMGEALETDKPKESEEASKYPRFAEGNRAYGYNPTPTKKDGVRRPVTKTALHQIKRQSSS
AQPTEEVLTLSSSSDSEVGSGTNGSKKPAAQATANDSDDIQTISSGSDEEEEKKNVAASA
GPVKRQVAVKSTRGFALKSTHGITVKSNMASGEGGPGRRNTRQFFDGEESCYIIDAKLEG
NLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKK
LLCCCGSTECRGRLL

BLAST