GenomeNet

>xla:443836 tgm2; transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase); K05625 transglutaminase 2 [EC:2.3.2.13] (A)
MAEELFLESFDLDCSGNNRSHRTAEASCERLIVRRGQPFQITLNFAPRGYEEGVDRLSLN
AITGPCPSEESGTSNNFPVSDALQDGAWSAAINSTDGGTVILSITSPPNARIGYYNLSLE
TSTEYQGSSFQLGSFTLLFNPWCPEDSVYLEKKDERKEYVLCQHGIIFQGTKNSTDHVPW
NFGQFEDGILEIALQILDTSPKFLNDSNRDCSRRNDPVYISRVISAMVNCNDDKGVLYGR
WDNKYDDGVSPMFWMGSVAILRRWKKFGCQAVKYGQCWVFAAVACTVLRCLGIPARVITN
YNSAHDTNSNLLIEQYLDEHGKRQSKQKDLIWNYHCWVEVWMARPDLGEDYNGWQVVDPT
PQEKSEGTYCCGPAPVNAVKEGDLNVKYDVPFVFAEVNADVMYYVQQNDGSVKKTHSISL
VGQNISTKAIGKDEREDITHNYKYPEGSQDERRVFEKANKQFVEAEEEEEKPLDVTIKIK
VSEGMNIGSDFDVFAVITNNTEDEKKCRLMFCARTTSYNGEVGPECGMKDLLNLTLPPQE
EKRVPLHIQYEKYGPTITENNMIKLVAMLYDYSSKDIILAMRDIHIKNPSIKIKILGEPK
QKRKLVAEISLKNPLAEPLTGCCFTVEGAGLTAEQLVQTLDCPIEPGQEAKVRVDLMPQL
PGKLSLVVDFESDLLKAVKGYRNIIIAPLPK

BLAST