GenomeNet

>xla:444121 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (RefSeq) MGC80496 protein (A)
MFNLRTCASKLRPLTASQTVRSLTHKKPAAPRTFQQFRCLSTPVAAEPFLSGTSSNYVEE
MYYAWLENPKSVHKSWDIFFRNANAGASPGAAYQSPPPLGSSLSTLSQAQSLVQARPNID
KLVGDHLAVQSLIRAYQVRGHHIAKLDPLGISSVNFDGAPVIVGSPNVGFYGLEESDLDK
VFHLPTTTFIGSNEMALPLREIIRRLESAYCQHIGVEFMFINDLEQCQWIRQKFETPGIM
QFNSEEKRTLLARLVRSTRFEEFLHRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDY
VIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEATDEGSGDVKYHLGMYHRRINRVTDR
NITLSLMANPSHLEAADPVVQGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETF
HLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVM
YVCNVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKTVLQKYAETL
VSQGVVNQSEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMTC
PSTGLSEEELTHIGNVASSVPVEDFTIHGGLSRILKGRGEMVKNRTVDWALAEYMSLGSL
LKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYG
VLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFVCPGQAKWVRQNGIVLLLPHGME
GMGPEHSSARPERFLQMCNDDSDVWPKASEDFAVRQLYDCNWIVVNCSTPANFFHVIRRQ
ILLPFRKPLIVFTPKSLLRHPEARSSFDDMLAGTHFERIIPDAGPASQNPEGVKRLIFCA
GKVYYDLTKERSGRGMEGDVAITRVEQLSPFPFDLVEKEVQKYPNADLVWCQEEHKNQGY
YDYVKPRLRTTIHRAKPVWYAGRDPAAAPATGNKKTHLTELKRLLDTSFNLDSFKGHS

BLAST