GenomeNet

>xla:444121 MGC80496 protein; K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] (A)
MFNLRTCASKLRPLTASQTVRSLTHKKPAAPRTFQQFRCLSTPVAAEPFLSGTSSNYVEE
MYYAWLENPKSVHKSWDIFFRNANAGASPGAAYQSPPPLGSSLSTLSQAQSLVQARPNID
KLVGDHLAVQSLIRAYQVRGHHIAKLDPLGISSVNFDGAPVIVGSPNVGFYGLEESDLDK
VFHLPTTTFIGSNEMALPLREIIRRLESAYCQHIGVEFMFINDLEQCQWIRQKFETPGIM
QFNSEEKRTLLARLVRSTRFEEFLHRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDY
VIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEATDEGSGDVKYHLGMYHRRINRVTDR
NITLSLMANPSHLEAADPVVQGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETF
HLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVM
YVCNVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKTVLQKYAETL
VSQGVVNQSEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMTC
PSTGLSEEELTHIGNVASSVPVEDFTIHGGLSRILKGRGEMVKNRTVDWALAEYMSLGSL
LKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYG
VLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFVCPGQAKWVRQNGIVLLLPHGME
GMGPEHSSARPERFLQMCNDDSDVWPKASEDFAVRQLYDCNWIVVNCSTPANFFHVIRRQ
ILLPFRKPLIVFTPKSLLRHPEARSSFDDMLAGTHFERIIPDAGPASQNPEGVKRLIFCA
GKVYYDLTKERSGRGMEGDVAITRVEQLSPFPFDLVEKEVQKYPNADLVWCQEEHKNQGY
YDYVKPRLRTTIHRAKPVWYAGRDPAAAPATGNKKTHLTELKRLLDTSFNLDSFKGHS

BLAST