GenomeNet

>xla:446459 hsp90ab1, hsp90b, hsp90beta; heat shock protein 90kDa alpha (cytosolic), class B member 1; K04079 molecular chaperone HtpG (A)
MPEVAHNGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKDLKIDIIPNRLERTLTMIDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVKVDTGEPIGRGTK
VILHLKEDQTEYLEEKRVKETVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKEEKKEE
EGENDKPKIEDVGSDEEEEGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYG
EFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFI
MDSCDELIPEYLNFVRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFCELAED
KENYKKFYEGFSKNLKLGIHEDSTNRKKLSELLRYHTSQTGDEMASLTEYVSRMKENQKS
IYYITGESKDQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKTLVSVTKEGLE
LPEDEEEKKTMEENKTKFESLCKLMKEILDKKVEKVTVSNRLVSSPCCIVTSTYGWTANM
ERIMKAQALRDNSTMGYMMAKKHLEINPEHPIVETLRQKADTDKNDKAVKDLVVLLFETA
LLSSGFSLDDPQTHSNRIYRMIKLGLGIDDDDAPIEEASPSVPDDIPPLEGEEDASRMEE
VD

BLAST