GenomeNet

>xla:446459 K04079 molecular chaperone HtpG | (RefSeq) hsp90ab1.S, hsp90ab1, hsp90b, hsp90beta; heat shock protein 90kDa alpha family class B member 1 S homeolog (A)
MPEVAHNGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKDLKIDIIPNRLERTLTMIDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVKVDTGEPIGRGTK
VILHLKEDQTEYLEEKRVKETVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKEEKKEE
EGENDKPKIEDVGSDEEEEGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYG
EFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFI
MDSCDELIPEYLNFVRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFCELAED
KENYKKFYEGFSKNLKLGIHEDSTNRKKLSELLRYHTSQTGDEMASLTEYVSRMKENQKS
IYYITGESKDQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKTLVSVTKEGLE
LPEDEEEKKTMEENKTKFESLCKLMKEILDKKVEKVTVSNRLVSSPCCIVTSTYGWTANM
ERIMKAQALRDNSTMGYMMAKKHLEINPEHPIVETLRQKADTDKNDKAVKDLVVLLFETA
LLSSGFSLDDPQTHSNRIYRMIKLGLGIDDDDAPIEEASPSVPDDIPPLEGEEDASRMEE
VD

BLAST