GenomeNet

>xla:446502 prkacbb; protein kinase, cAMP-dependent, catalytic, beta b; K04345 protein kinase A [EC:2.7.11.11] (A)
MGNAATAKKGGEIESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VRQKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMV
MEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFST
TDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEEEIRVSITEKCAKEFSEF

BLAST