GenomeNet

>xla:447267 cyp21a2.1, ca21h, cah1, cps1, cyp21, cyp21b, p450c21b; cytochrome P450, family 21, subfamily A, polypeptide 2, gene 1; K00513 steroid 21-monooxygenase [EC:1.14.99.10] (A)
MRNDLEKVLIREARLLCQDCLDLNGEPVDISRSFSLRTCRIIAELTFGTTYDFTDPDFQK
IHKCIIDIIKLWESPSVTALDFIPFLQKFPNQTLNLLLETAKQRDSFIKSQVEAHKAHLP
SSKYNEDILDGMIRLIREKSGDDSNGMSEFSEDHLHMAVVDLFIGGTETTASLLTWTVAY
LMHYPEAQERIHQEITGAVGTERYPTYTDRNRMPYLNATISEMLRLRPVVPLAVPHCTIK
DTSIAGYTIPKGTTVIPNIYAAHLDETIWDNAAQFCPDRFLSPSESSNSARALLPFSVGA
RLCIGETLARMEVFFFLSHLLRDYRLLSPSPKLLPQLSGMFGINLKCHPFMVCISPRENT
PKILDFNKET

BLAST