GenomeNet

>xla:734470 K02602 cytoplasmic polyadenylation element-binding protein | (RefSeq) cpeb1.S, CPEB, Cpeb-1, cpeb1, cpeb1-a, cpeb1-b; cytoplasmic polyadenylation element binding protein 1 S homeolog (A)
MAFPLKDDLGRAKDCWGCSSDTPALSTCSNADIFRRINAMLDNSLDFTGVCTTPNTKGKC
EHLQDYPDTEGAAASRMLFSTSHEPLPRGLPDTNDLCLGLQSLSLTGWDRPWSTQDSEAG
GQSSTPTAAQSVFSMLNSPMGKPSPLGFLPLDPIGSDLVEKYPTHLLRSSRFDSRSILDS
RSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLPLGSGISRDPLRLGVGSRLDQDHA
ALAAATASPLGITKRWPGTSVWPSWDLLDSADDPFSIEREARLHRQAAAVNEATCTWSGQ
LPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKGNMP
KGYVYLVFESEKSVRALLQACTQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNF
VRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTF
NNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCR
SCWHWQHSMEILRHHRPLMRNQKSRDSS

BLAST