GenomeNet

>xla:734470 cpeb1-b, CPEB; cytoplasmic polyadenylation element binding protein 1; K02602 oo18 RNA-binding protein (A)
MAFPLKDDLGRAKDCWGCSSDTPALSTCSNADIFRRINAMLDNSLDFTGVCTTPNTKGKC
EHLQDYPDTEGAAASRMLFSTSHEPLPRGLPDTNDLCLGLQSLSLTGWDRPWSTQDSEAG
GQSSTPTAAQSVFSMLNSPMGKPSPLGFLPLDPIGSDLVEKYPTHLLRSSRFDSRSILDS
RSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLPLGSGISRDPLRLGVGSRLDQDHA
ALAAATASPLGITKRWPGTSVWPSWDLLDSADDPFSIEREARLHRQAAAVNEATCTWSGQ
LPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKGNMP
KGYVYLVFESEKSVRALLQACTQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNF
VRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTF
NNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCR
SCWHWQHSMEILRHHRPLMRNQKSRDSS

BLAST