GenomeNet

>xma:102225521 K05625 transglutaminase 2 [EC:2.3.2.13] | (RefSeq) protein-glutamine gamma-glutamyltransferase 2 isoform X1 (A)
MAQALDIERWNLECLFNNTDHRTDLNGVDRLIVRRGQPFTVSLYLRSGSYQPGISSLDCV
AETGPQPSEQYGTRARFGLSSSMDTSTWSATVTSPPGDMVALSICSSPKAPIGRYTLTLG
QSEKIEFVLLFNPWCPADAVYMDNEQNLAEYVLSQDGIIFRGSSKHTIPTPWNFGQFESG
ILDICLRILDMNPKCLRNPGKDYSGRRNPIYVTRVLSAMVNCNDDKGVLLGKWTDGYEGG
VSPLVWRGSVEILRNWDTQSCQPVRYGQCWVFAAVACSVSRALGIPCRVITNYLSAHDTN
SNLVIERYVNENGELIQSREMIWNYHCWVESWMTRPDLKPDFDGWQASDPTPQEKSEGVY
CCGPIPLRAIKEGELAFKYDAPFVFAEVNADVVTVMKKKDGSTSKVTTIGLVGQMISTKS
VGSDSREDVTHLYKYPEGSDEEREAFKKANHLNKLLQENPDPGLHVTIKVTSDMRKGCDF
DVFAVVTNNTEEEKKCRLVFGSCAVSYNGVLGGNCGFKDLLNVQLPPGAERRVPLRLNYS
KYGDQVTEDNLIRLAVLLHNYSTGEAKLAMRNIVLDNPEIKVRILGEPKENRKLAAEISL
QNPLPEPLDNCCFSIEGANLTGGNIISERLGCTVGPGEDAKVKIYFTPTHSGLRKLVVDF
DSNKLCHVKGYRNVIIGK

BLAST