GenomeNet

>xma:102230089 protein-glutamine gamma-glutamyltransferase 2-like; K05625 transglutaminase 2 [EC:2.3.2.13] (A)
MSEVKEVKEGSEDFIVDVDLRSHENNLAHRTREIDRERLIVRRGQPFSITVQCSDSLPPK
HQLELVLHLGKRDEVVVKVQKQRGVGDSWWFSQQEAQGEILLTLQSPADAVIGQYRLVVL
LMSPDGRIVETVDEVSFHVLFNPWCKDDVVYLPDERLLQEYIMNEDGVIFMDTWDYIKSI
PWSYGQFEDFVMDICFEVLDNSKEALHNSKMDIESRSDPIYVSRMVTAMVNANGDRGVLI
GRWRAPYLDGVAPNRWTGSVPILRQWSKSGIRAVKYGQCWVFAGVACTVLRCLGIPTRLI
TNFCSAHDVDGNLSLDFVVDFESREEKTDSKWNFHCWVESWMRRDDLPKGNDGWQVLDPT
PQELSDGEFCCGPCPVAAIKEGNLGVKYDAPFVFAEVNADIVYWNVLPDGQRQQISTDQR
NVGRNISTKSVYGDFREDITLLYKYPEGSVEEREVYKKAKRRATLQPNESVEPAQLSLSI
KHPNPVFGTDFDVIVEVKNEGGDDANVHLTVHAMAVTYNSLHQGECQRQMNNVTVSAQNA
HKEVLRFRYDDYAKCVSDHHLIRVKALAEAQGNSLPIMAVADIPLSLPELHIQVLGKAFV
WEQLTASISFTNPLPVPLTGGVFTLEGAGLLSDTHIYVDGVISPGQKVSVKIAFTPMRTG
VRKLLVDFDSDRLKDVKGVISVVVRKKYRNTLPVLSGRF

BLAST