GenomeNet

>xma:102230510 K00699 glucuronosyltransferase [EC:2.4.1.17] | (RefSeq) UDP-glucuronosyltransferase 2A2-like isoform X1 (A)
MELRLSVCVLLLLCATRSSNGGKILVWYTEASHWINIKPVLETLVDRGHQVTVLIPSASM
FMNSSEPSRFQYEPFNTSLSVKDMEKFLQEFLQFGIYEMDFMGYFQIYIRFIELIKNNMK
FSFSMLDGVVKSETIMKKLKEGNYDVLFSDPVYVGSDLTADILDIPLVYSLRFSLAHNWE
RMCGQLPAPPSFVPAAISKLTDKMDFSERLWNVLFYALQDVIVDQFMWKEIDKYYSEVRG
TPTNACKMKGKADIWLMRTYWDFDFPRPLLPNFKFIGGIHCKPAKPLPKEMEKFVESSGD
AGIVVFSLGSMVKNLTTEKANMIASALAQIPQKVLWRYSGEKPQTLGSNTRTYDWIPQND
LLGHPKTKAFITHGGTNGIYEAIYHGVPMVGIPMFGDQPDNMVHMQAKGAALTVKLNFMT
IESLRDAVNTIINDKSYKENMMRLSRIHHDRPMSPLDEAVFWIEFTMRNKGAKHLRVQAH
ELTWYQYHSLDVLAFLLIIDLLLIFILFKSCSFCFKRCCGRKQTKRKAE

BLAST