GenomeNet

>xop:PXO_04473 angiotensin-converting enzyme, testis-specific isoform (ACE-T) (Dipeptidyl carboxypeptidase I)(Kininase II); K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MNPRLLLLALAVAVGTLSLSACRRDAAPPAKPVATKTAPAESADQFVARISAQYKAAYPE
TTAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSRQYAGTPMSADSARALQLLKLM
SALPAPRDAAKLAELTRIAAKMEGDYGAGSYCVGEGEQRRCRQLGELEQVLASSRDYNEQ
LDAWQGWHSTARPMRKDYQRFVELANEGARGFGFADVGVLWRSGYDMPPAQLASETDRLW
EQVKPLYVQLQCYARGKLDTQYGKDKGEVPGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLTAVLARNTGGVGGATARFNAEHEAQLRTAKQMTERAQEFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEANQNIGADVRTKMCIQPTEEDFT
TIYHELGHLYYDLAYKPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQRTGR
EALINWQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVSA
RGEDFFDPGAKYHVPGNTPYTRYFLAHILQFQFYKSLCQAAGHQGPLYECSFYRNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSEWLKQQNQGQMCGWQAAAAA
PASTTTAPAAPR

BLAST