GenomeNet

>xtr:100124743 setdb2, clld8, clll8, kmt1f; SET domain, bifurcated 2 (EC:2.1.1.43); K18494 histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43] (A)
MERSTNARHSTLSSWTRESNTLSVLSKDVSLEDAKEYWKDCQADGKVDWIFEKLLNKLKI
LWQKIKDGSATNLEYVRAVILVNEAEQLEEDTETLHTDIQKENKVQENTDCAPERKEDSC
ADLNSDCETDVSGSECEHEDHSTVSPPATGAVCFGKHLCGPSCLSDINPSLLKKENPLNL
PVSCDFQRWRVKTNGSEYPPHILYKAPCGRSLRDSDEVHSYLTETGCHFLGVDNFSFSTQ
VQLESHLSIKQEIVQDCDISNDVESVPVSLSNEIDDTRPTNFIYRKTSWPPGYSINNFTD
IFVKCCSCTDGCLDISTCSCLQLTAQAFEKFTDSSLGIGPLGYKHKRLQEPVPTGLYECN
LSCKCDRTLCQNRVVQHGLQLRLQVFKTDTKGWGVRCLDDVDNGTFVCIYAGRILIRTAD
SSVKTTLEDSVACGNEAKEDNGSTSTLMLSKRKRKPSHSDSEVTVMHLTPYSMRSLGLSV
HRQSNTLSLTHLRSGGREISLEPFRRPKTKTSMLQKRRRQLIEEGACTVHNSSEEEGPTP
PQSPKQKFNAGRKIHRNENSDETASGYVSEESSSSVISGGHPSEKPTCRTKSKLNKMTPH
LSTSPEQTCEEDLHFLDASKEGNVGRFLNHSCCPNLFVQHVFVDTHQKSFPWVAFFTNSV
VKAGTELTWDYNYVIGTAPDQEIQCLCGQQTCKHKIV

BLAST