GenomeNet

>xtr:100135741 setmar; SET domain and mariner transposase fusion gene (EC:2.1.1.43); K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] (A)
MAQTGPSAAAMAPEDVCCGTERLAVPVSGPWENLPAFQYTPELIAGPGAEQDPSEVTIQG
CDCRGSNCVAELCSCLPHGTNYVRRTIVSGQRPVRECHIMCSCGESCPNRETQQGLQYQL
QLCQRPGKGWGVCTLEDIPSGRFVCEYAGEVLGHEQARSRTLSQNPCANNYIIAVREHLH
GGQILQTFVDPTHIGNVGRFLNHSCDPNLFMMPVRTHSMVPKLALFAARDIQAGEELCYD
YSGKFFNQTPACETLDPEEPSSRKKCQCGARACSGFLPYESSLF

BLAST