GenomeNet

>xtr:100144634 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) ace, ace1, cd143, dcp, dcp1, xace; angiotensin I converting enzyme (A)
MRVLLLGLLLLVGTNSALDSSFLPGTYPKDEAGARDFADAYNSTAEVILFKSVEASWAYN
TNLTDYNSKQQILASMEEQEFNEAWGMKAKELFNDVWENFTDPLLKKIISSIRTLGASNL
NLTAREEYNTILSEMDSIYSTAKVCPPNATAKCWSLEPEITEIMATSRSYKKLLYAWEGW
HNSAGIPLKEKYLRFVQLSNEAYRMDGYKDTGAYWRSWYASPTFEEDLDGLYQQLEPLYL
NLHAFVRRKLYERYGAKYINLKGPIPAHLFGNMWSQQWNNIYDMMIPFPDKTNIDVTNTM
REKGWNATHMFRVSEEFFTSLGLLEMPPEFWEKSMLEKPADGREVVCHASAWDFYNRKDF
RIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTYRRGANPGFHEAIGDVLSLSVSTPG
HLKTIGLLETVTNDKESDINYLLKMALEKIAFLPFGFLIDQWRWNVFSGRTPPTRYNYDW
WNLRTKYQGICPPISRDDNQFDAGAKYHIPGNTPYIRYFVSFVLQFQFHKALCTAAKHTG
PLHTCDIYRSQEAGKILGDVLRSGSSKSWQEVLKDMTGSEKMDVGPLLEYFTPVTQWLIE
QNTKNNEILGWPDFSWTPPMPDGYPGDIEKIANEKEADTFLSDYTKSAEVVWNDYTEASW
AYNTNITEANKQVMLDKNLAMSGHTLQYGLQARNYDYSDFQDPETQRILRKLSEIDKAAL
SEEEQKEYNQITSDMETIYSVAKVCKDGNTNCHPLDPDLTEILAKSRDYDELLFAWKGWR
DASGKQIREKYKRYVQLANKAAQLNGYNDNGAYWRSWYETPTLESDVEKLYDELQPLYLN
LHAYVRRALYKKYGDKRINLKGPIPAHLLGNMWAQSWSNIYELLVPYPNAAQVDATPAMI
AKNWTPKRMFEESDNFFKSLGLLPMPQEFWDKSMIEKPKDREVVCHASAWDFYNRKDFRI
KQCTVVNMDDLITVHHEMGHVQYFLQYKDQPILFREGANPGFHEAIGDVLALSVSTPKHL
QSIGLLDKVEDNPESDINYLMSIALDKIAFLPFGFLMDQWRWKVFDGRTPDSEYNQQWWN
LRLKYQGLVPPVLRTENDFDPGAKFHIPASVPYIRYFISFVIQFQFHEALCKAANQEGPL
HKCDIYQSTQAGKLLGDAMKLGNSKPWPEAMQTITGQRNMSAHALLKYFQPLTDWLIKEN
TKNGETLGWPEYNWSPVQSVPLPPSGDSNSDFLGLAVSNSQAAAGQWILLALGIVLIITT
IVFGVLYSKMKSRAKMSSSQMELK

BLAST