GenomeNet

>xtr:100145045 mapk12; mitogen-activated protein kinase 12; K04441 p38 MAP kinase [EC:2.7.11.24] (A)
MESGPRKGFYRQDINKTKWDVPVRYRDLAAVGSGAYGTVCSAQDRLTGERVAIKKLLRPF
QSLVHAKRAYRELRLLKHMKHENVISLLNVFTPDESMETFQTFYLVMPFIAVDLSRVMRM
QRLNHSTIVYLLYQILRGLQYIHAAGIVHRDLKPSNLGVNEDYELKILDFGLARPTEFEM
TGYVVTRWYRAPEVILNWMHYNHTVDIWSVGCILAEMITGKVLFPGGDYFDELNKIIEVT
GSPQPSLINKMESSHAQDYVKMLPKKQKKNFKELFPTMSAVETDLLEKMLDLDPGTRVNA
TEALAHPYLEEYNDSDPDPTADKYDDSFESLDLNVHEWKSLSHMEIMTFEPMKPSQAST

BLAST