GenomeNet

>xtr:100485935 K05624 transglutaminase 6 [EC:2.3.2.13] | (RefSeq) protein-glutamine gamma-glutamyltransferase 6-like (A)
MAEHRTNYYSSSDLILRRAQAFRIMLYFNRPLREKDKVEFTAATGPDPQEADDTMCIFPL
FGSQSKASWTAEVDSIDSNCVTAIITSSADAVIGRYKLQLYTTSSKKKSYFKLREFVLLF
NPWAEDDVVYMEDENERCEYVLNDHGIIYFGHEEMIDEQGWDFGQFEENILDISLQILDR
SLNYQDDPVLDCSQRYDPGYVGRVLTAMINSFDDDGVLEGRWTGKFTGGVDPQHWIGSVE
ILMRWYRGGYKPVKYGQCWVFAAVMCTVLRCLGIPTRVITNFASAHDKDGNLGIDSIYSS
SGRNMSKDTMWNFHVWNESWFRRNDLGSAYRGWQVLDATPQELSEGTYCCGPASVHAVKE
GDVDKDYNVPFVFAEVNADRNTWVYYAKDVKEKVYTDSKSVGKHMSTKSVGGNERVEITN
NYKYPEGTEKERQVYLKARKKLLDMGVLKDENLGRRFIGKKRYKKRGRASESADDSEEPT
ELGIIGKFQLVAPPKFGDDVNLILSLRNSGQKSEALKVKLSSSAIKYTGRPMSEIFSDQT
SVTLGSMKGNAYNNLFD

BLAST