GenomeNet

>xtr:100485935 protein-glutamine gamma-glutamyltransferase E-like; K05624 transglutaminase 6 [EC:2.3.2.13] (A)
MAEHRTNYYSSSDLILRRAQAFRIMLYFNRPLREKDKVEFTAATGPDPQEADDTMCIFPL
FGSQSKASWTAEVDSIDSNCVTAIITSSADAVIGRYKLQLYTTSSKKKSYFKLREFVLLF
NPWAEDDVVYMEDENERCEYVLNDHGIIYFGHEEMIDEQGWDFGQFEENILDISLQILDR
SLNYQDDPVLDCSQRYDPGYVGRVLTAMINSFDDDGVLEGRWTGKFTGGVDPQHWIGSVE
ILMRWYRGGYKPVKYGQCWVFAAVMCTVLRCLGIPTRVITNFASAHDKDGNLGIDSIYSS
SGRNMSKDTMWNFHVWNESWFRRNDLGSAYRGWQVLDATPQELSEGTYCCGPASVHAVKE
GDVDKDYNVPFVFAEVNADRNTWVYYAKDVKEKVYTDSKSVGKHMSTKSVGGNERVEITN
NYKYPEGTEKERQVYLKARKKLLDMGVLKDENLGRRFIGKKRYKKRGRASESADDSEEPT
EAKH

BLAST