GenomeNet

>xtr:100487270 K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] | (RefSeq) setd1a; SET domain containing 1A (A)
MVRCPQMEPEGESHRGAGFQWRSYKLLLDPALHSRRTTQKVYRYDGIHFNISDGAFLPLG
DVRDPRQHRMWSKPREISLPVPKFKFDEFYVGQLPQKEITFAHLNDNVREPFLADMCRKF
GDVEEVEILLHPKTRKHLGLAKVLFSSSKAARDTVTHLHNTSVMGNIIHAELDLRGQQRQ
KYYDLIVNGSYNPQTVPTSGRWAQERLQPDMVDSRRRLSSDSSSYLPNNGTPSSQDLGSS
YSQYTPSSSQGTPYTPRSGTPFSQDSAYSSRQGTPSHSSSQDTSGYKSRRQENSSGDSYS
RRSGHHYSPAPSSSTSSSSSQHESSQKRFHRHQNRSSPQSSYRSRHRKPPPPPEEPPLIR
FPGTPPLPPPPPPPPPPDDIHTDRDYRIAHPPPLPPSIPAPSTTILVPPPPPTEGWEPPP
PPLPPLPPVCSPPPSPARSCSPLLDGVSESLPFTQHSSSLDSRIEALLKEQRSKFSFLPS
DTEEEEEATTEAPTQEPVVVEEVPPVHGPYTPPLPASFEDVSAEAILRMAEIGRTANGQD
RGMLMQEPPFLRDPSSWSRNSLPPQLLSSGEDMEISDEEINMEMPGAAVPPFPLLPHLPG
AAGTFQSQPIPSPLLPLPPHHPQPPSPFPLLPNTAARGRLGDLAAGSSTPPALDPSSSSS
ASSAPHIYDFVNSMELVNRLGNQWGGTSMSFQMQTQMLSRLQQNRQGKNMPFEDPYPPPL
LPHPIPPRLHQPHPPPPLMPEQVFNPTFPPFPAQQPQPLLPPREFTARTARGPSQEPRGP
GWAPGGGVDPHASTIESVLSALIQEMKNTMQRDLNRKMVENVAFRAFDEWWERKEEKAKP
FQNVAKPPPREEDKEKARPKEPGLLSLVDWAKSGGAEGFGFGSGLREALRLPSFKVKRKQ
PSEDEDSEQKRPRPSTPAEEEQDEREKETESDSRQGGKLPQQEGKRVHKRRRPFHLDSEG
EEASEESASDKDDEEDELSEKGEDSEEEVSPLTKLSSKIISDDDSDSSSESDSSSSSSSS
SSSSSSASSSASTPASSDDEEEQEETPDLLSVSEPPRPPSPASPLPELEAAADKKEPLDI
PPATEVKEEQSTEIPEPPLPPPPEPPSKPHAPPSPPLQLLPPPKKRRKTVSFQLLPEEEA
EAADSKPPNHHVPENAAPERPISPLLEPMHLLPTPTDKAPLPSPEAPTAPTAELHSSPKP
EPEEPPLPAKEASPRKQPPERLTVLNLPWDHASLVKPYPPRVRSEDNMEEEAEEDFEKHL
EEEEVKPPPPIEAPTQPEPKSPLISEPSEVERTEFIEDLLFAPVRQILLEHSYASIPAAL
KQPPRKQRLSVELEKPNELVHVDLGQAVLEAPEEVVCIGGGLAVDGETGLLDVGDLDISS
PRKMEEALAKLVHDEPKIKSKRTLAKEAEPGEVTSEEEDEEEMWVTTRQLRSHRNRKAAQ
RQLPPLYEIRSEFEQMTILYDIWNTGLDFEDMVFLRDTYERLLQEDHSTDWLNDTHWVHH
PITNIADPKRRKNRQDGLREHQTGCARSEGYYAISKKDKDKYLKVLLVAAEEQEADTQGT
NRVLSERRSEQRRLLSAMGSTALLDSDLLKLNQLKFRKKKLRFGRSHIHEWGLFAMEPIA
ADEMVIEYVGQNIRQMVADMREKRYSQQGIGSSYLFRMDQDTIIDATKCGNLARFINHCC
SPNCYAKVITIESQKKIVIYSKQPIGINEEITYDYKFPLEDNKIPCLCGTENCRGTLN

BLAST