GenomeNet

>xtr:550047 K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] | (RefSeq) ezh2, enx-1, enx1, ezh1, ezh2-a, ezh2-b, kmt6, xez, xtezh2; enhancer of zeste 2 polycomb repressive complex 2 subunit (EC:2.1.1.43) (A)
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFNTNRQKIMERTEILNQEW
KQRRIQPVHIMTTVSSLRGTRECSVTSDLDFPKQVIPLKTLTAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALAQ
YSDYEDDEDGDDNQDDERDDTAKDQDDNMEDQETQPLRKFPSDKIFEAISSMFPDKGTLE
ELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHP
FHATPNTYKRKNNEAANDGKPCGPHCYQLLEGAREFAAALTAERIKTPPKRPSGRRRGRL
PNNTSRPSTPTVNVLEAKDTDSDREAGTETGGESNDKEEEEKKDETSSSSEANSRCQTPI
KMKPNIEPPENVEWSGAEASLFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIA
PVIAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVI
AQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKN
VSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVY
DKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQT
GEELFFDYRYSQADALKYVGIEREMEIP

BLAST