GenomeNet

>xtr:780106 setd1b; SET domain containing 1B (EC:2.1.1.43); K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MSFKEAKPGERGKNPEDHGRKQTASWINGMEAGNQPSTSGEKKSHHWRSYKLIIDPALRK
GQHKLYRYDGLSFSMPNSGVPPVDSVRDPRIGRIWTKTKELDLPVPKLKIDEFYVGPVPP
KQVTFAKLNDNIRENFLGDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFASVKGARDAVK
HLHNTSVMGNIIHVELDTKGETRMRFYDLLVNGFYTPQTLPVGSDLDASPTVNETPQVVE
SVKRTKETAIGPSVTPNSSTPFSHDTAYSSSRQGTPNSYSQFTPQSQGTPHTPRLGTPFS
QDSSYSSRQTTPAFHYGQDSGFKPRRHENKFTDAYNRRPGHHYVHSSGSYRGTEHTFNVT
RPQPEPVQVPRTPPLSHSSGNYKSAFSPYQGNTVFPQTDESQYPQTSRDMEYRRTGPQTS
DSYSDAGCNSASLELKPVKEKPEEPPPPEPDSTTEQKASFSQTPERCETPGTPTLEAELQ
HNSLDTRIAMLLKEQRTQLHLIAGDQNSDNEIRMEGSPISSSSSQLSPIPPYSSGSRYQD
VTPSSRPSSTGLEDISPTPLPDSDDDDEPIPGTASLCQNSRSASPIDQINQSGRKTESLD
KKELVAGDETPTSEKMDEGHPSSGEDMEISDDEVTPSPITSAECAITSSSVISSVIPIPP
PGFPPLPPPPPPQPGFPMPPPLPPPPPPTHPSVTVPPPPLPAPPGVPPHHILHHPPPYHH
FPVMQGEMMNVLGNHWGGMTMSFQMQTQMLSRMMQGQGSYPYHHFMGGSMQFGNQHPYRP
FAISAHLTRGQPWPPFPKFDPSVPPPGYEHKKEDPHKATVDGVLQVIVKELKAIMKRDLN
RKMVEVVAFRAFDEWWDKKERLAKQSLTPVKSGESKEEDKQKTKEHITSSLLESWNKGEG
LGFEGIGLGIGLRGAIRLPSFKVKRKEPPDAALAGDQKRIRPSHSVDDEDEESERDRDIS
STASDLSKKDADAVNNRRRPARPLDSEGEEEVESEGDDGETSDKEDSSSEKEDQDDGSVS
ALSSKKQLYGDKEGDDEDDDTQSSGKEEDLVSEEEDTTSVASSRAEMDSSDESEESSEYE
SSSDSDEKEEEDDEEEELVFGDDQSEDQDLGQEYEVETDREEDFFRENLSECSSLPKAGD
VELEDEMQKVEEDVARQTTQETLHLRKKNLDVPLVESKECKQDTLDKVEKLFAVPMQEEV
FKEHEKAPSPMNEEEEYIELQLEPVPLVPEGAAPAAQEPVIIRPLTPTGAFGETGPVLKL
EEPKLQVNLTQFATEDEELYPRTPGRDTAAHSDTEVTFQPGLKVAPSSLPFLPSHNKEEE
CLLPPEKHAGHLTVTKMLSEEDLPRTPGRDIVVKSSHLGKSQSTETVPATPGSDAPLTGS
SLTLTSPHIPGSPFSYLSQSPGIINSGIPRTPGRDFNFTPTFPESNSIFPCHPSGKKPSV
DEPDEKSFKEPTSASLTMNSVPSPIPFASPPRGLPHMDIRLGADDLESSDTPAYLSDKLL
SEESECEFTKVHLTSTDESAPSPPLPPAEKRKGDRSKKPLSAHEFETEKNYETSSAVAMS
EGALGKQMFIGQPDAVSGIKDPAAVPLDFRNDSLSENTVHEPIIQKVPLKELENQWNEVL
KEEEDITKHKKSRNSRHNNRYDEFSTVPSPEFSPPRAMFKPRSEFEEMTILYDIWNGGID
DEDIKYMCITYDRLLQQDNGMDWLNDTLWVYHPSTSVYSPKKKKRDDGLREHVTGCARSE
GYYKIDKKDKLKYLINNRSLTEELPIDTQGKSIPAQPQASTRAGSERRSEQRRLLSSFTG
SCDSDLLKFNQLKFRKKKLRFCKSHIHDWGLFAMEPIIADEMVIEYVGQNIRQVIADMRE
KRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSK
QYINVNEEITYDYKFPIEDVKIPCLCGAENCRGTLN

BLAST