GenomeNet

>yep:YE105_C0212 K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] | (GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit B (A)
MKFDVIIIGGGLAGLVCGIRLAEQGKYCAIVSAGQNALHFSSGSLDLLAKLPNGQAVSQP
LSAFETLAELAPEHPYSKMGQTGQVGELAQQAESLLSRCGLNLVGSAAKNHLRLTPLGNC
RPTWLSPADIPVAPLEGPLPWQKVAVIGIEGFLDFQPQMVASALQEQGVEVTADYLHLPA
LDRLRDNPSEFRAVNIARVLDLPENLQPLADELARLSSTAEMILLPACIGLDESAPLDAL
RAAVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGGIVMPGDAVLRAELVGNRVTGLYSR
NHGDIPLRAAQMVLASGSFFSNGLVATFEHVYEPILDLDILSLPNRADWSNSNMFAPQPY
LQFGVNTDNRLRALRGGVALDNLHVIGAVLGGYDPLQQGCGAGVSLTSALFVAEQIVSAM
EVTL

BLAST