GenomeNet

>yep:YE105_C2283 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAL
LYNSGTSLLSIITTEHQEKPVHCILLDECQFLTKDQVQELCQVVDELHIPVLCYGLRTDF
LGELFPGSKYLLSWADKLVELKTICHCGRKANMVLRLDAQGRAVHDGEQVVIGGNESYVS
VCRRHYKEAIKAACLQQYP

BLAST