GenomeNet

>yep:YE105_C3255 hydrogenase 2 large subunit; K06281 hydrogenase large subunit [EC:1.12.99.6] (A)
MSQRITIDPVTRIEGHLRIDCEIEDGKVIKAWSSGTMWRGMEEILQGNDPRDAWMIVQRI
CGVCTTIHAIASVRAVENALGMEVPVNAQHIRNLILAAHSIHDHIVHFYQLSALDWVDVT
SALQASPQKAAAMLSGLSSWPLNSAEEFTRVQQKIKDLVASGQLGIFANGYWGHPAMALP
PEVNLIAVAHYLQALECQRDANRIVAVLGGKTPHIQNLAVGGVANPINLDMPSVLNLERL
MLVKSFIDRLGSFIEQVYKVDTAVIAAHYPNWLNLGKGADYYLSVPELPIDRKGENFLLP
GGYLENGTFRPIANHNDPYLIKGIAESGKHAWYQDDEPLAPWEGKTNPNYTGWQEDGKYS
WVKAPTFYGKTVEVGPLAWLMCGLAAGHAPTKQHFTDIGAAYQKLSGQAITAEQLPSTLG
RIIGRAVHCCVLHETLAQQWTALVTNIGTGDIETFIKPNIPLSGEIRGVGFEEAPRGMLS
HWVVIKDGKIANYQAVVPSTWNAGPRNYNDEPGPYEQALVGTPVADPAKPLEVVRTIHSF
DPCMSCAVHIVDTTGNEVTKIKVL

BLAST