GenomeNet

>ypd:YPD4_1895 hypothetical protein; K01792 glucose-6-phosphate 1-epimerase [EC:5.1.3.15] (A)
MPVVVVSHPKVRAAISLQGAHLLAYQPSGEQPIIWLSNNTPFKEGIAIRGGVPICWPWFG
PTAQPAHGFARILPWTLSAHDENENGVILTFTLEDNDMTRQYWPHAFTLIARFKLGDECE
VELESHGDYQAAAALHTYFQIGDISQIKVSGLGEKYLDKVLKVADVTQQGDLVFNGQTDR
VYTQPEAYSLIKDAALKRTIEVHHHHQSDVVAWNPGAELSCSMVDMPNDGYKTMVCVETA
RVNKPLVAAPDAPARLAMTIRSRKNT

BLAST